Invitrogen™ Human NDUFB2 (aa 54-105) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100093	100 μL

Catalog No. RP100093 Supplier Invitrogen™ Supplier No. RP100093

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62394. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane.

Specifications

• Accession Number: O95178
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4708
• Name: Human NDUFB2 (aa 54-105) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1810011O01Rik; 8kDa; AGGG; AI325567; CI-AGGG; complex I AGGG subunit; complex I-AGGG; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial; NADH:ubiquinone oxidoreductase subunit B2; NADH-ubiquinone oxidoreductase AGGG subunit; NDUFB2
• Common Name: NDUFB2
• Gene Symbol: NDUFB2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining