Invitrogen™ Human NDUFB6 (aa 15-49) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100221	100 μL

Catalog No. RP100221 Supplier Invitrogen™ Supplier No. RP100221

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60579. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Methylation of cytosine at CpG dinucleotides is a common feature of many higher eukaryotic genomes. Increasing evidence indicates that recruitement of histone deacetylase complexes by methyl-CpG-binding proteins (MeCP) is a major mechanism of methylated DNA silencing. P66, a zinc finger-containing protein is one of the components of the MeCP1 complex. P66 and p68, the two components of MeCP1 are different forms of the same zinc finger-containing protein and are conserved from C.elegans to humans. Homologs of p66 from different organisms revealed two highly conserved regions, CR1 and CR2. While CR1 is involved in the association of p66 with other MeCP1 components, CR2 plays an important role in targeting p66 and MBD3 to specific loci.

Specifications

• Accession Number: O95139
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4712
• Name: Human NDUFB6 (aa 15-49) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: B17; CI; CI-B17; complex I, mitochondrial respiratory chain, B17 subunit; complex I-B17; Gm137; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; NADH:ubiquinone oxidoreductase subunit B6; NADH-ubiquinone oxidoreductase B17 subunit; NADH-ubiquinone oxidoreductase beta subunit, 6; NDUFB6
• Common Name: NDUFB6
• Gene Symbol: NDUFB6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining