Invitrogen™ Human NEDD4L (aa 160-194) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105336	100 μL

Catalog No. RP105336 Supplier Invitrogen™ Supplier No. RP105336

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66713. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NEDD4L is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4L inhibits TGF-beta signaling by triggering SMAD2 and TGFR1 ubiquitination and proteasome-dependent degradation. NEDD4L promotes ubiquitination and internalization of various plasma membrane channels such as ENaC, Nav1.2, Nav1.3, Nav1.5, Nav1.7, Nav1.8, Kv1.3, EAAT1 or CLC5. NEDD4L also promotes ubiquitination and degradation of SGK.

Specifications

• Accession Number: Q96PU5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23327
• Name: Human NEDD4L (aa 160-194) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1300012C07Rik; E3 ubiquitin-protein ligase NEDD4-like; FLJ33870; HECT-type E3 ubiquitin transferase NED4L; hNEDD4-2; KIAA0439; NEDD4; NEDD4 like E3 ubiquitin protein ligase; NEDD4.2; Nedd4-2; nedd4b; NEDD4L; NEDL3; neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase; neural precursor cell expressed, developmentally down-regulated gene 4b; neural precursor cell expressed, developmentally down-regulated gene 4-like; RSP5; ubiquitin-protein ligase Nedd4-2; ubiquitin-protein ligase Rsp5; Unknown (protein for IMAGE:7986262)
• Common Name: NEDD4L
• Gene Symbol: NEDD4L
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining