Invitrogen™ Human NELF (aa 394-511) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93053	100 μL

Catalog No. RP93053 Supplier Invitrogen™ Supplier No. RP93053

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60674. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NELF (nasal embryonic luteinizing hormone-releasing hormone factor) is a 530 amino acid transcription factor involved in the migration of LHRH neurons, outgrowth of olfactory axons and suppression of transcription elongation. NELF is found in the peripheral and central nervous system during embryonic development, and is highly expressed in adult testis, kidney and brain. Known to couple NMDA receptor signaling to the nucleus, NELF knockdown impaired GnRH neuronal migration of NLT cells in vitro and the gene encoding NELF has been linked to the development of Idiopathic hypogonadotropic hypogonadism (IHH), a disorder resulting in impaired pubertal maturation and reproductive function.

Specifications

• Accession Number: Q6X4W1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 26012
• Name: Human NELF (aa 394-511) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: HH9; Jac; Jacob; Jacob protein; Juxtasynaptic attractor of caldendrin on dendritic boutons protein; nasal embryonic LHRH factor; Nasal embryonic luteinizing hormone-releasing hormone factor; NELF; NMDA receptor synaptonuclear signaling and neuronal migration factor; NSMF
• Common Name: NELF
• Gene Symbol: NSMF
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining