Invitrogen™ Human NeuN (aa 104-137) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109505	100 μL

Catalog No. RP109505 Supplier Invitrogen™ Supplier No. RP109505

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Fox-3, also known as NEUN, HRNBP3, RBFOX3 (RNA binding protein, fox-1) or Fox-1 homolog C, is a 350 amino acid protein that contains one RRM (RNA recognition motif) domain. Localized to both the nucleus and cytoplasm, Fox-3 is suggested to regulate alternative splicing events. Fox-3 is encoded by a gene located on human chromosome 17, which is comprised over 2.5% of the human genome and encodes over 1,200 genes. Two key tumor suppressor genes are associated with chromosome 17, namely, p53 and BRCA1. Tumor suppressor p53 is necessary for maintenance of cellular genetic integrity by moderating cell fate through DNA repair versus cell death. Malfunction or loss of p53 expression is associated with malignant cell growth and LiFraumeni syndrome. Like p53, BRCA1 is directly involved in DNA repair, though specifically it is recognized as a genetic determinant of early onset breast cancer and predisposition to cancers of the ovary, colon, prostate gland and fallopian tubes.

Specifications

• Accession Number: A6NFN3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 146713
• Name: Human NeuN (aa 104-137) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: D11Bwg0517e; FLJ56884; FLJ58356; fox 1 homolog (C. elegans) 3; fox1 homolog C; Fox-1 homolog C; FOX3; FOX-3; FOX3NeuN; hexaribonucleotide binding protein 3; hexaribonucleotide binding protein 3 (HRNBP3); Hexaribonucleotide-binding protein 3; Hrnbp3; NEUN; NeuN antigen; Neuna60; neuronal nuclear antigen A60; neuronal nuclei; Neuronal nuclei antigen; RBFOX3; RFOX3; RGD1560070; RNA binding fox-1 homolog 3; RNA binding protein; RNA binding protein fox-1 homolog 3; RNA binding protein, fox-1 homolog (C. elegans) 3; RNA binding protein, fox-1 homolog 3
• Common Name: NeuN
• Gene Symbol: RBFOX3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining