Invitrogen™ Human Neurocan (aa 30-110) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95631	100 μL

Catalog No. RP95631 Supplier Invitrogen™ Supplier No. RP95631

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83354. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Neurocan is a gene encoding a large chondroitin sulfate proteoglycan, predominantly expressed in the central nervous system. Located on chromosome 19 in humans, neurocan is part of the lectican family of proteoglycans, integral to the extracellular matrix where they modulate neuronal cell adhesion and migration. This proteoglycan is essential in the formation of the neural network during development and in maintaining the plasticity of the extracellular matrix in adult brains. Neurocan undergoes proteolytic processing, resulting in various fragments that influence neuronal growth and synapse stabilization. Altered neurocan expression has been linked to several neurological conditions such as schizophrenia, bipolar disorder, and Alzheimer's disease, likely due to its role in synaptic function and integrity of the neural matrix. Understanding neurocan's exact roles in neurological health and disease could illuminate pathways for potential therapeutic interventions targeting matrix remodeling and neuronal connectivity.

Specifications

• Accession Number: O14594
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1463
• Name: Human Neurocan (aa 30-110) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 245 kDa early postnatal core glycoprotein; C230035B04; Chondroitin sulfate proteoglycan 3; chondroitin sulfate proteoglycan 3 (neurocan); chondroitin sulfate proteoglycan 3, related sequence; Cspg3; Cspg3-rs; NCAN; NEUR; neurocan; neurocan core protein; neurocan proteoglycan; TGFbeta-induced transcript, brain; Tgfbit
• Common Name: Neurocan
• Gene Symbol: Ncan
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining