Invitrogen™ Human NFYC (aa 140-275) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106594	100 μL

Catalog No. RP106594 Supplier Invitrogen™ Supplier No. RP106594

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CCAAT-binding factor NF-Y is a heteromeric transcription factor that specifically binds to CCAAT sequences in many eukaryotic genes. NF-Y is made up of three subunits, NF-YA, NF-YB and NF-YC. All three components are necessary for DNA binding. In each NF-Y subunit, the segment needed for formation of the NF-Y-DNA complex is conserved from yeast to human. These conserved segments are homologous to the histone-fold motif of eukaryotic histones. The DNA binding domains of the NF-YB and NF-YC subunits have been suggested to interact through a protein-protein histone-fold 'handshake' motif in a manner analogous to the histone proteins, H2B and H2A, respectively.

Specifications

• Accession Number: Q13952
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4802
• Name: Human NFYC (aa 140-275) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CAAT box DNA-binding protein subunit C; CAAT-box DNA-binding protein subunit C; CBFC; CBF-C; CCAAT binding factor of CBF-C/NFY-C; CCAAT binding factor subunit C; CCAAT transcription binding factor subunit gamma; CCAAT-binding transcription factor subunit C; DKFZp667G242; fb98f01; FLJ45775; H1TF2A; HAP5; histone H1 transcription factor large subunit 2A; HSM; NFYC; NF-YC; Nuclear transcription factor Y subunit C; nuclear transcription factor Y subunit gamma; nuclear transcription factor Y, gamma; nuclear transcription factor-Y gamma; transactivator HSM-1; transactivator HSM-1/2; transcription factor NF-Y, C subunit; wu:fb98f01; zgc:55514
• Common Name: NFYC
• Gene Symbol: NFYC
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining