Invitrogen™ Human NHE3 (aa 564-657) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96811	100 μL

Catalog No. RP96811 Supplier Invitrogen™ Supplier No. RP96811

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83336. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NHE3 (also known as SLC9A3 - Sodium/hydrogen exchanger 3) is a member of the sodium/hydrogen exchanger family that plays a crucial role in acid-base and volume homeostasis by mediating the majority of sodium and bicarbonate reabsorption in the proximal tubule of the kidney. Mutations in the gene can lead to Diarrhea 8.

Specifications

• Accession Number: P48764
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6550
• Name: Human NHE3 (aa 564-657) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9030624O13Rik; AI930210; DIAR8; MGC126718; MGC126720; Na(+)/H(+) exchanger 3; Na/H exchanger 3; Na+/H+ exchanger homolog; Na+/H+ exchanger isoform 3; membrane ion exchange protein; Nhe3; NHE-3; NHE-3 antibody; plasma membrane ion transport protein; putative sodium hydrogen exchanger subtype 3; Slc9a3; SLC9A3 antibody; sodium proton exchanger; sodium/hydrogen exchanger; sodium/hydrogen exchanger 3; sodium/hydrogen exchanger isoform 3; Solute carrier family 9 (sodium/hydrogen exchanger 3), antiporter 3, Na+/H+ (amiloride insensitive); solute carrier family 9 (sodium/hydrogen exchanger), isoform 3; solute carrier family 9 (sodium/hydrogen exchanger), member 3; solute carrier family 9 member 3; solute carrier family 9 member A3; solute carrier family 9, member 3; solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3
• Common Name: NHE3
• Gene Symbol: SLC9A3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQSLEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining