Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108234

Invitrogen™ Human NHERF2 (aa 231-281) Control Fragment Recombinant Protein

Catalog No. RP108234
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108234 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108234 Supplier Invitrogen™ Supplier No. RP108234
Add to Cart
Add to Cart

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84728. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NHE3 is a sodium/hydrogen exchanger in the brush border membrane of the proximal tubule, small intestine, and colon that plays a major role in transepithelial sodium absorption. SLC9A3R2, as well as SLC9A3R1 and protein kinase A phosphorylation, may play a role in NHE3 regulation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15599
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 9351
Name Human NHERF2 (aa 231-281) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 0610011L07Rik; 1200011K07Rik; 2010007A20Rik; E3karp; HGNC:11076; MGC104639; Na(+)/H(+) exchange regulatory cofactor NHE-RF2; NHE3 kinase A regulatory protein E3KARP; NHE3 regulatory factor 2; NHE3RF2; Nherf2; NHERF-2; OCTS2; SIP1; SIP-1; SLC9A3 regulator 2; SLC9A3R2; sodium/hydrogen exchanger; sodium/hydrogen exchanger 3 kinase A regulatory protein; Sodium-hydrogen exchanger regulatory factor 2; solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 2; solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatory factor 2; solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2; solute carrier family 9 isoform 3 regulator 2; solute carrier family 9 isoform 3 regulator 2, isoform A; sodium/hydrogen exchanger; solute carrier family 9 isoform A3 regulatory factor 2; solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2; Sry interacting protein 1; SRY-interacting protein 1; Sryip1; TKA-1; tyrosine kinase activator protein 1
Common Name NHERF2
Gene Symbol SLC9A3R2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.