Invitrogen™ Human NHP2L1 (aa 2-126) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91397	100 μL

Catalog No. RP91397 Supplier Invitrogen™ Supplier No. RP91397

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83073. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: P55769
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4809
• Name: Human NHP2L1 (aa 2-126) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: [U4/U6.U5] tri-snRNP 15.5 kD RNA binding protein; 15.5K; CTA-216E10.8; FA1; FA-1; Fertilization antigen 1; fertilization antigen-1; Fta1; high mobility group-like nuclear protein 2 homolog 1; hSNU13; NHP2 non-histone chromosome protein 2-like 1; NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae); NHP2L1; NHP2-like protein 1; NHP2-like protein 1, N-terminally processed; NHPX; non-histone chromosome protein 2-like 1; Otk27; small nuclear ribonucleoprotein 15.5kDa (U4/U6.U5); SNRNP15-5; SNU13; SNU13 homolog; SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5); SPAG12; sperm specific antigen 1; sperm-specific antigen 1; Ssfa1; U4/U6.U5 small nuclear ribonucleoprotein SNU13; U4/U6.U5 tri-snRNP 15.5 kDa protein; U4/U6.U5] tri-snRNP 15.5 kDa protein
• Common Name: NHP2L1
• Gene Symbol: SNU13
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining