Invitrogen™ Human NIFK (aa 89-177) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103831	100 μL

Catalog No. RP103831 Supplier Invitrogen™ Supplier No. RP103831

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83284. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NIFK, also known as nucleolar protein interacting with the forkhead homolog protein, is a gene associated with several cancer types and is considered a potential prognostic biomarker. This gene functions within the nucleolus and plays a critical role in cellular proliferation, metastasis, and invasiveness, particularly noted in hepatocellular carcinoma (HCC) and colorectal cancer. NIFK expression is regulated via several pathways, including the MYC proto-oncogene pathway, and its silencing can lead to decreased fatty acid synthesis in colorectal cancer cells. Furthermore, it's involved in the regulation of innate immunity through pathways such as NF-kB in specific cancer cells. Due to its involvement in cancer progression, NIFK is being explored as a therapeutic target and holds promise for advancing precision medicine strategies across various cancer treatments.

Specifications

• Accession Number: Q9BYG3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 84365
• Name: Human NIFK (aa 89-177) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI852665; C130020J04Rik; hNIFK; Ki67ip; MKI67 (FHA domain) interacting nucleolar phosphoprotein; MKI67 FHA domain-interacting nucleolar phosphoprotein; MKI67IP; mNIFK; NIFK; NOPP34; nucleolar phosphoprotein Nopp34; nucleolar protein interacting with the FHA domain of MKI67; nucleolar protein interacting with the FHA domain of pKI-67; spermatogenesis-related protein (Srp)
• Common Name: NIFK
• Gene Symbol: Nifk
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining