Invitrogen™ Human NIPA4 (aa 345-404) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96939	100 μL

Catalog No. RP96939 Supplier Invitrogen™ Supplier No. RP96939

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58315. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NIPAL4 acts as a Mg(2+) transporter and can also transport other divalent cations such as Ba(2+), Mn(2+), Sr(2+) and Co(2+) but to a much less extent than Mg(2+). NIPAL4 may also be a receptor for ligands (trioxilins A3 and B3) from the hepoxilin pathway. The NIPAL4 gene likely encodes a membrane receptor. Mutations in the NIPAL4 gene have been associated with autosomal recessive congenital ichthyosis. Diseases associated with NIPAL4 include Ichthyosis, Congenital, Autosomal Recessive 6 and Autosomal Recessive Congenital Ichthyosis.

Specifications

• Accession Number: Q0D2K0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 348938
• Name: Human NIPA4 (aa 345-404) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9530066K23Rik; ARCI6; ICHN; Ichthyin; ICHYN; Magnesium transporter NIPA4; NIPA like domain containing 4; Nipa4; NIPAL4; NIPA-like domain containing 4; NIPA-like protein 4; Non-imprinted in Prader-Willi/Angelman syndrome region protein 4; non-imprinted in Prader-Willi/Angelman syndrome region protein 4 homolog; RGD1309452
• Common Name: NIPA4
• Gene Symbol: NIPAL4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FKDLDISCASLPHMHKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining