Invitrogen™ Human NLRC4 (aa 756-889) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89236	100 μL

Catalog No. RP89236 Supplier Invitrogen™ Supplier No. RP89236

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NLRC4 encodes a member of the caspase recruitment domain-containing NLR family. Family members play essential roles in innate immune response to a wide range of pathogenic organisms, tissue damage and other cellular stresses. Mutations in this gene result in autoinflammation with infantile enterocolitis. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q9NPP4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 58484
• Name: Human NLRC4 (aa 756-889) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9530011P19Rik; AIFEC; CARD, LRR, and NACHT-containing protein; Card12; caspase recruitment domain family, member 12; caspase recruitment domain-containing protein 12; CLAN; Clan protein; CLAN1; CLANA; CLANB; CLANC; CLAND; CLR2.1; FCAS4; ice protease-activating factor; ICE-protease activating factor; ipaf; NLR family CARD domain containing 4; NLR family CARD domain-containing protein 4; NLR family, CARD domain containing 4; NLRC4; NOD-like receptor C4; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 4; UNQ6189/PRO20215
• Common Name: NLRC4
• Gene Symbol: Nlrc4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TDSLGNLKNLTKLIMDNIKMNEEDAIKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKILAQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining