Invitrogen™ Human NLRP6 (aa 612-721) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97487	100 μL

Catalog No. RP97487 Supplier Invitrogen™ Supplier No. RP97487

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60466. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NALP proteins include the apoptosis regulator APAF1 (apoptotic protease activating factor 1) and mammalian NOD-LRR proteins and are thought to be involved in inflammation and reproduction. NALP6, also known as PYPAF5, is highly expressed in granulocytes and T cells and co-localizes with the PYRIN-CARD protein ASC. Co-expression of NALP6 with ASC results in a synergistic activation of NF-kappa-B and activated caspase-1-dependent cytokine processing, suggesting that NALP6 functions in immune cells to coordinate the transduction of pro-inflammatory signals.

Specifications

• Accession Number: P59044
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 171389
• Name: Human NLRP6 (aa 612-721) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI504961; angiotensin II/vasopressin receptor; angiotensin/vasopressin receptor; AVR; CLR11.4; dual angiotensin II/vasopressin receptor; NACHT, leucine rich repeat and PYD containing 6; NACHT, LRR and PYD domains-containing protein 6; NACHT/LRR/pyrin domain-containing protein 6; NALP6; Navr; Navr/Avr; NLR family pyrin domain containing 6; NLR family, pyrin domain containing 6; Nlrp6; Non-angiotensin-vasopressin receptor; Non-AVR; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 6; PAN3; Pypaf5; PYRIN-containing APAF1-like protein 5; PYRIN-containing APAF1-like protein 5-like
• Common Name: NLRP6
• Gene Symbol: NLRP6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GEEPNYPLELLYCLYETQEDAFVRQALCRFPELALQRVRFCRMDVAVLSYCVRCCPAGQALRLISCRLVAAQEKKKKSLGKRLQASLGGGSSSQGTTKQLPASLLHPLFQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining