Invitrogen™ Human NME1 (aa 1-67) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89745	100 μL

Catalog No. RP89745 Supplier Invitrogen™ Supplier No. RP89745

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NME1 was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in the gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Specifications

• Accession Number: P15531
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4830
• Name: Human NME1 (aa 1-67) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AL024257; AWD; expressed in non-metastatic cells 1; expressed in non-metastatic cells 1 protein; expressed in non-metastatic cells 1 protein (NM23A) (nucleoside diphosphate kinase); expressed in non-metastatic cells 1, protein; expressed in non-metastatic cells 1, protein (NM23A) (nucleoside diphosphate kinase); GAAD; Granzyme A activated DNase (GAAD); Granzyme A-activated DNase; GZMA activated DNase; included; metastasis inhibition factor NM23; NB; NBR-A; NBR-B; NBS; NDK A; NDK A 1; NDK A 2; NDK NBR-A; NDK NBR-B; NDKA; NDP kinase A; NDP kinase A 1; NDP kinase A 2; NDP kinase beta; NDP kinase NBR-A; NDPKA; NDPK-A; NM23; NM23A; NM23-C1; NM23-H1; NM23H1B; nm23-M1; NME/NM23 nucleoside diphosphate kinase 1; Nme1; NME1-1; NME1-NME2 spliced read-through transcript; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; nucleoside diphosphate kinase A 1; nucleoside diphosphate kinase A 2; nucleoside diphosphate kinase NBR-B; nucleoside-diphosphate kinase 1; nucleoside-diphosphate kinase NBR-A; nucleotide diphosphate kinase; nucloside diphosphate kinase; tumor metastatic process-associated protein
• Common Name: NME1
• Gene Symbol: NME1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining