Invitrogen™ Human nNOS (aa 1036-1104) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109190	100 μL

Catalog No. RP109190 Supplier Invitrogen™ Supplier No. RP109190

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NOS activity requires homodimerization as well as three cosubstrates (L-arginine, NADPH and O2) and five cofactors or prosthetic groups (FAD, FMN, calmodulin, tetrahydrobiopterin and heme). Several distinct NOS isoforms have been described and been shown to represent the products of three distinct genes. These include two constitutive Ca2+/CaM-dependent forms of NOS, including NOS1 (also designated ncNOS) whose activity was first identified in neurons, and NOS3 (also designated ecNOS), first identified in endothelial cells.

Specifications

• Accession Number: P29475
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4842
• Name: Human nNOS (aa 1036-1104) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310005C01Rik; bNOS; bNOS1; Brain NOS; Constitutive NOS; IHPS1; NC-NOS; neuronal nitric oxide synthase; neuronal nitric oxide synthase NOS1; neuronal NOS; nitric oxidase synthase; nitric oxide synthase; nitric oxide synthase 1; nitric oxide synthase 1 (neuronal); nitric oxide synthase 1, neuronal; nitric oxide synthase, brain; nNOS; N-NOS; nNOS; NOS type I; NO; NOS; NOS Type 1; NOS type I; Nos1; Nos-1; NOS-I; Peptidyl-cysteine S-nitrosylase NOS1; Phospho-bNOS; Phospho-Brain NOS
• Common Name: nNOS
• Gene Symbol: NOS1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining