Invitrogen™ Human NPRL2 (aa 241-309) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96300	100 μL

Catalog No. RP96300 Supplier Invitrogen™ Supplier No. RP96300

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58290. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NPRL2, also known as TUSC4 (tumor suppressor candidate 4), is a 380 amino acid protein that contains a bipartite nuclear localization signal and a granulin protein-binding domain. It is highly expressed in skeletal muscle, followed by brain, liver and pancreas, with lower expression in lung, kidney, placenta and heart. NPRL2 is also expressed in most lung cancer cell lines and may be involved in tumor suppression. NPRL2 may play a role in mismatch repair, cell cycle checkpoint signaling and activation of apoptotic pathways. It may also enhance the therapeutic efficacy of chemotherapy drugs such as cis-platin by resensitizing patients resistant to cisplatin treatment. The gene encoding NPRL2 is conserved between species and is expressed as two isoforms due to alternative splicing events.

Specifications

• Accession Number: Q8WTW4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10641
• Name: Human NPRL2 (aa 241-309) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2810446G01Rik; G21; G21 protein; GATOR complex protein NPRL2; Gene 21 protein; homologous to yeast nitrogen permease (candidate tumor suppressor); nitrogen permase homolog; nitrogen permease regulator 2-like protein; nitrogen permease regulator-like 2; nitrogen permease regulator-like 2 (S. cerevisiae); NPR 2L; NPR L2; NPR like 2; NPR2; NPR2 like; NPR2L; NPR2-like protein; NPR2-like, GATOR1 complex subunit; NPRL 2; Nprl2; Tumor suppressor candidate 4; TUSC 4; TUSC 4 protein; TUSC4; TUSC4 protein
• Common Name: NPRL2
• Gene Symbol: NPRL2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining