Invitrogen™ Human NR0B1 (aa 248-323) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108524	100 μL

Catalog No. RP108524 Supplier Invitrogen™ Supplier No. RP108524

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.

Specifications

• Accession Number: P51843
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 190
• Name: Human NR0B1 (aa 248-323) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: adrenal hypoplasia, congenital homolog; AHC; Ahch; AHX; DAX; DAX 1; Dax1; DAX-1; DSS; DSS-AHC critical region on the X chromosome protein 1; GTD; HHG; Nr0b1; NROB1; nuclear hormone receptor; nuclear receptor DAX-1; Nuclear receptor subfamily 0 group B member 1; nuclear receptor subfamily 0, group B, member 1; orphan nuclear receptor DAX-1; R0B1; SRXY2
• Common Name: NR0B1
• Gene Symbol: NR0B1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining