Invitrogen™ Human NRG4 (aa 1-58) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90456	100 μL

Catalog No. RP90456 Supplier Invitrogen™ Supplier No. RP90456

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52762. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Neuregulin 4 (NRG4) is a member of the Neuregulin family serving as a ligand for the epidermal growth factor receptor (EGFR) family, specifically interacting with ERBB4. This gene is primarily expressed in brown adipose tissue and liver, where it plays a pivotal role in metabolic regulation. NRG4 acts as a critical signaling molecule in adipose tissue, promoting systemic glucose homeostasis and energy expenditure while inhibiting hepatic lipogenesis, thereby contributing to protection against diet-induced obesity and insulin resistance. Moreover, NRG4 expression is inversely correlated with adiposity and positively correlated with insulin sensitivity, suggesting its potential role in metabolic homeostasis. Studies reveal that NRG4's interaction with ERBB4 stimulates specific cellular pathways, which can impact hepatic gluconeogenesis, underscoring its importance in glucose metabolism. Additionally, NRG4 has been linked to breast cancer progression, where it contributes to tumor cell survival through signaling pathways involving receptor tyrosine kinases. Due to its significant involvement in metabolic pathways and cancer biology, NRG4 is considered a promising target for therapeutic intervention in metabolic disorders and certain cancers.

Specifications

• Accession Number: Q8WWG1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 145957
• Name: Human NRG4 (aa 1-58) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI552600; heregulin 4; HRG4; neuregulin 4; Neuregulin-4; NRG4; NRG-4; Pro-neuregulin-4, membrane-bound isoform; pro-NRG4
• Common Name: NRG4
• Gene Symbol: NRG4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining