Invitrogen™ Human NUP210L (aa 530-613) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103791	100 μL

Catalog No. RP103791 Supplier Invitrogen™ Supplier No. RP103791

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64164. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nup210L (nuclear pore membrane glycoprotein 210-like) is a 1,888 amino acid single-pass membrane protein that belongs to the NUP210 family. The gene that encodes Nup210L consists of approximately 162,432 bases and maps to human chromosome 1q21.3. Chromosome 1 is the largest human chromosome spanning about 260 million base pairs and making up 8% of the human genome. There are about 3,000 genes on chromosome 1, and considering the great number of genes there are also a large number of diseases associated with chromosome 1. Notably, the rare aging disease Hutchinson-Gilford progeria is associated with the LMNA gene which encodes lamin A. When defective, the LMNA gene product can build up in the nucleus and cause characteristic nuclear blebs. The MUTYH gene is located on chromosome 1 and is partially responsible for familial adenomatous polyposis. Stickler syndrome, Parkinsons, Gaucher disease and Usher syndrome are also associated with chromosome 1.

Specifications

• Accession Number: Q5VU65
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 91181
• Name: Human NUP210L (aa 530-613) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Nuclear pore membrane glycoprotein 210-like; nuclear pore membrane glycoprotein 210-like (LOC91181); Nucleoporin 210 kDa-like; nucleoporin 210 like; nucleoporin 210kDa like; nucleoporin 210kDa-like; nucleoporin 210-like; nucleoporin Nup210-like; NUP210L; RGD1310250
• Common Name: NUP210L
• Gene Symbol: NUP210L
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VQNPFRYGEIKIHVLKLNKMELLPFHADVEIGQIIEIPIAMYHINKETKEAMAFTDCSHLSLDLNMDKQGVFTLLKEGIQRPGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining