Invitrogen™ Human NUP98 (aa 1455-1549) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108019	100 μL

Catalog No. RP108019 Supplier Invitrogen™ Supplier No. RP108019

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111725. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Signal-mediated nuclear import and export proceed through the nuclear pore complex (NPC), which is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is generated through a biogenesis pathway that involves synthesis and proteolytic cleavage of a 186 kDa precursor protein. This cleavage results in the 98 kDa nucleoporin as well as a 96 kDa nucleoporin, both of which are localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromosome translocations in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL). This gene is one of several genes located in the imprinted gene domain of 11p15. 5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.

Specifications

• Accession Number: P52948
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4928
• Name: Human NUP98 (aa 1455-1549) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4732457F17; 96 kDa nucleoporin; 98 kDa nucleoporin; ADAR2; adir2; AI849286; GLFG-repeat containing nucleoporin; im:7151238; LOW QUALITY PROTEIN: nuclear pore complex protein Nup98-Nup96; Nuclear pore complex protein Nup96; Nuclear pore complex protein Nup98; nuclear pore complex protein Nup98; nuclear pore complex protein Nup98-Nup96; nuclear pore complex protein Nup98-Nup96; nucleoporin 98; nucleoporin 98 and 96 precursor; nucleoporin 98 L homeolog; nucleoporin 98kD; nucleoporin 98kDa; Nucleoporin Nup96; Nucleoporin Nup98; NUP196; Nup96; NUP98; nup98.L; NUP98/PHF23 fusion 2 protein; Nup98-Nup96; OTTHUMP00000013954; zgc:113968; zgc:63593; zgc:63593 protein
• Common Name: NUP98
• Gene Symbol: NUP98
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining