Invitrogen™ Human OCIAD2 (aa 4-55) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98482	100 μL

Catalog No. RP98482 Supplier Invitrogen™ Supplier No. RP98482

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59421. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OCIAD2 was identified by its sequence similarity with OCIAD1, and together OCIAD1 and OCIAD2 form the OCIA domain family. OCIAD2 mRNA was found to be expressed at higher levels in invasive adenocarcinoma mixed subtype with bronchioloalveolar carcinoma component (BAC) of the lung. Loss of OCIAD2 expression was significantly correlated with lymphatic invasion, blood vessel invasion, and lymph node metastasis, indicating that OCIAD2 may play a role in cell adhesion and prevention of cell migration. While the function of OCIAD2 is still unknown, its expression in adenocarcinoma with BAC component is significantly associated with a favorable prognosis and may serve as a marker for selecting tumors that are treatable by limited surgery.

Specifications

• Accession Number: Q56VL3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 132299
• Name: Human OCIAD2 (aa 4-55) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1810027I20Rik; OCIA domain containing 2; OCIA domain-containing protein 2; OCIAD2; Ovarian carcinoma immunoreactive antigen-like protein
• Common Name: OCIAD2
• Gene Symbol: OCIAD2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASARGNQDKDAHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining