Invitrogen™ Human Oncomodulin (aa 1-41) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99262	100 μL

Catalog No. RP99262 Supplier Invitrogen™ Supplier No. RP99262

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Oncomodulin, encoded by the OCM gene located on chromosome 7p22.3, is a protein that belongs to the parvalbumin family of calcium-binding proteins. It is most prominently found in the inner ear, as well as in certain retinal cells and regenerating neurons. Oncomodulin plays a crucial role in calcium ion homeostasis, which is vital for various cellular processes, including signal transduction, cellular motility, and growth. Notably, oncomodulin has been studied for its role in promoting nerve regeneration, particularly within the central nervous system, where it enhances axonal growth and neuronal repair. This makes it a molecule of significant interest for therapeutic strategies aiming to treat nerve injuries or neurodegenerative diseases. Beyond its neuroregenerative potential, oncomodulin is also expressed in some tumor types, which initially led to its association with cancer-related studies. Current research continues to explore its dual roles in both oncology and neurobiology to better understand its functional implications across different tissues.

Specifications

• Accession Number: P0CE72
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 654231
• Name: Human Oncomodulin (aa 1-41) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: hCG18255; Ocm; OCM1; Ocm2; OCMN; OM; ONCM; oncmodulin; oncomodulin; oncomodulin 1; oncomodulin 2; oncomodulin-1; Parvalbumin beta
• Common Name: Oncomodulin
• Gene Symbol: Ocm
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining