Invitrogen™ Human OPA1 (aa 707-803) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96480	100 μL

Catalog No. RP96480 Supplier Invitrogen™ Supplier No. RP96480

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57874. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OPA1 is a dynamin-related GTPase that is critical for the maintenance of mitochondrial morphology and mtDNA. The most commonly associated phenotype with OPA1 mutations is heterozygous optic atrophy, a heterozygous dominant trait that causes reduced visual clarity and sometimes blindness. The disease usually begins in childhood and increases in severity throughout the life of affected individuals. Usually, this phenotype is attributed to the degeneration of optic nerve fibers. Interestingly, the same type of nerve degeneration seems to be partially causative of certain schizophrenia characteristics. OPA1 dysfunction also seems to be implicated in this case; mitochondrial networks associated with critical nerves seem to link schizophrenia and OPA1. The dysfunction is associated with issues with apoptosis and normal cellular metabolic regulation, all regulated through OPA1.

Specifications

• Accession Number: O60313
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4976
• Name: Human OPA1 (aa 707-803) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1200011N24Rik; AI225888; AI847218; BERHS; Dynamin-like 120 kDa protein, form S1; Dynamin-like 120 kDa protein, mitochondrial; dynamin-like guanosine triphosphatase; EMBL:AAI11072.1}; hypothetical protein; KIAA0567; Large GTP-binding protein; largeG; lilr3; MGM1; mitochondrial dynamin-like GTPase; mitochondrial OPA1; mKIAA0567; MTDPS14; NPG; NTG; OPA1; opa1 {ECO:0000312; OPA1 mitochondrial dynamin like GTPase; OPA1, mitochondrial dynamin like GTPase; optic atrophy 1; optic atrophy 1 (autosomal dominant); optic atrophy 1 homolog; optic atrophy 1-like protein; optic atrophy protein 1; Optic atrophy protein 1 homolog; RCJMB04_1m16; RN protein
• Common Name: OPA1
• Gene Symbol: OPA1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining