Invitrogen™ Human ORAI2 (aa 1-50) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106605	100 μL

Catalog No. RP106605 Supplier Invitrogen™ Supplier No. RP106605

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65926. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Antigen stimulation of immune cells triggers Ca++ entry through Ca++ release-activated Ca++ (CRAC) channels. ORAI2 is one of two mammalian homologs to ORAI1, a recently identified four-transmembrane spanning protein that is an essential component of CRAC. Like ORAI1, ORAI2 has been shown to function as a highly selective Ca++ plasma membrane channel that is gated through interactions with STIM1, the store-activated endoplasmic reticulum Ca++ sensor, although at a lesser efficacy than ORAI1.

Specifications

• Accession Number: Q96SN7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80228
• Name: Human ORAI2 (aa 1-50) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A730041O15Rik; C7orf19; calcium release-activated calcium channel 2; calcium release-activated calcium modulator 2 protein; CAP-binding protein complex interacting protein 2; CAP-binding protein complex-interacting protein 2; CBCIP2; H_NH0514P08.8; MEM142B; ORAI calcium release-activated calcium modulator 2; ORAI2; PP1729; Protein orai-2; putative protein ORAI2-2; RGD1310213; TMEM142B; Transmembrane protein 142B
• Common Name: ORAI2
• Gene Symbol: ORAI2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining