Invitrogen™ Human ORC6 (aa 174-247) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105567	100 μL

Catalog No. RP105567 Supplier Invitrogen™ Supplier No. RP105567

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84901. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis.

Specifications

• Accession Number: Q9Y5N6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23594
• Name: Human ORC6 (aa 174-247) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 6720420I10Rik; ORC 6; ORC6; ORC6L; origin recognition complex subunit 6; origin recognition complex, subunit 6; origin recognition complex, subunit 6-like
• Common Name: ORC6
• Gene Symbol: Orc6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining