Invitrogen™ Human OTUD6A (aa 59-129) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99994	100 μL

Catalog No. RP99994 Supplier Invitrogen™ Supplier No. RP99994

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62772. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA2 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Specifications

• Accession Number: Q7L8S5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 139562
• Name: Human OTUD6A (aa 59-129) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DUBA2; DUBA-2; EG408193; Hin6; Hin-6 protease; HSHIN6; OTU deubiquitinase 6A; OTU domain containing 6A; OTU domain-containing protein 6A; OTUD6A; RGD1560855
• Common Name: OTUD6A
• Gene Symbol: OTUD6A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining