Invitrogen™ Human p21 (aa 45-155) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105703	100 μL

Catalog No. RP105703 Supplier Invitrogen™ Supplier No. RP105703

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein p21 is a tumor suppressor protein which is an inhibitor of Cyclin-dependent kinases (CDK) and is transcriptionally activated by p53. P21 is important in the response of cells to genotoxic stress and a major transcriptional target of p53 protein. The occurrence of p21 in the nucleus executes binding and inhibition activity of cyclin dependent kinases Cdk1 and Cdk2, and blocks the transition from G1 phase into S phase or from G2 phase into mitosis after DNA damage, which enables the repair of damaged DNA. In the cytoplasm, p21 protein has an anti-apoptotic effect. P21 is able to bind to and inhibit caspase 3, as well as the apoptotic kinases ASK1 and JNK. P21 exhibits a dual function in carcinogenesis, and acts as a tumor suppressor, prevents apoptosis, and acts as an oncogene.

Specifications

• Accession Number: P38936
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1026
• Name: Human p21 (aa 45-155) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Activating Fragment 1; CAP20; cdk inhibitor CIP1; cdk inhibitor CIP1 (p21); CDKI; CDK-interacting protein 1; CDK-interaction protein 1; Cdkn1; CDKN1A; CDNK1A; CIP1; Cip1); cyclin dependent kinase inhibitor 1A; cyclin-dependent kinase inhibitor 1; cyclin-dependent kinase inhibitor 1A; Cyclin-dependent kinase inhibitor 1A (p21; cyclin-dependent kinase inhibitor 1A (P21); cyclin-dependent kinase inhibitor 1A (p21, Cip1); cyclin-dependent kinase inhibitor 1A variant 1; cyclin-dependent kinase inhibitor 1A variant 2; DNA synthesis inhibitor; MDA6; MDA-6; melanoma differentiation associated protein 6; melanoma differentiation-associated protein; Melanoma differentiation-associated protein 6; OTTHUMP00000016298; p21; p21>WAF1/CIP1>; p21Cip1; p21Cip1/Waf1; p21WAF; PIC1; putative cyclin-dependent kinase inhibitor 1A (p21/WAF1/CIP1); SDI1; SLC12A9; UV96; WAF1; Wild type p53 activated fragment 1 (WAF1); wild-type p53-activated fragment 1
• Common Name: p21
• Gene Symbol: CDKN1A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining