Invitrogen™ Human P2X5 (aa 105-184) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107603	100 μL

Catalog No. RP107603 Supplier Invitrogen™ Supplier No. RP107603

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66958. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The P2X5 gene encodes a protein that is a member of the purinergic receptor family, P2X receptors. These receptors are ligand-gated ion channels activated by extracellular ATP. The P2X5 protein is primarily involved in the regulation of skeletal muscle, immune response, and sensory neuron functions. Structurally, P2X5 features two transmembrane domains, a large extracellular loop, and intracellular N- and C-termini. P2X5 is known to form both homomeric and heteromeric channels, contributing to its functional diversity in various tissues.

Specifications

• Accession Number: Q93086
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5026
• Name: Human P2X5 (aa 105-184) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI852046; ATP receptor; ATP receptor subunit; ionotropic ATP receptor P2X5; LRH-1; lymphoid-restricted histocompatibility antigen-1; membrane magnesium transporter 2; membrane magnesium transporter 2 {ECO:0000250; MGC47755; Mmgt2; mmgt2 {ECO:0000250; P2 purinergic receptor subtype; P2RX5; P2X purinoceptor 5; P2X5; P2X5 purinoceptor; P2x5 receptor; P2X5R; Purinergic receptor; purinergic receptor P2X 5; purinergic receptor P2X, ligand gated ion channel, 5; purinergic receptor P2X, ligand-gated ion channel, 5; purinergic receptor P2X5-1; purinergic receptor P2X5-2; RGD1311260; UniProtKB:Q8R3L0}
• Common Name: P2X5
• Gene Symbol: P2RX5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining