Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human PACAP Receptor (aa 23-59) Control Fragment Recombinant Protein

Catalog No. RP101125
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101125 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101125 Supplier Invitrogen™ Supplier No. RP101125
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes type I adenylate cyclase activating polypeptide receptor, which is a membrane-associated protein and shares significant homology with members of the glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Alternative splicing of two exons of this gene generates four major splice variants, but their full-length nature has not been determined. PACAP receptor type 1 expression has been documented in adipose, adrenal, bone, brain, colon, ganglion, heart, lung, ovary, pancreas, placenta, spleen, and uterus. ESTs have been isolated from brain and nerve libraries.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P41586
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 117
Name Human PACAP Receptor (aa 23-59) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2900024I10Rik; ADCYAP receptor type I; ADCYAP1 R1; ADCYAP1R 1; Adcyap1r1; adenylate cyclase activating polypeptide 1 (pituitary) receptor type I; adenylate cyclase activating polypeptide 1 receptor 1; adenylate cyclase activating polypeptide 1 type 1 receptor; AI846590; alternatively spliced product of PACAP receptor; G-protein coupled receptor; PAC 1; PAC1; PAC1 receptor; Pac1 receptors; PAC1R; PAC1-R; PACAP R 1; PACAP Receptor; PACAP receptor 1; PACAP type I receptor; PACAP type IA receptor; PACAP/VIP receptors; PACAP1 R; PACAP1 receptor; PACAP1-R; PACAPR; PACAPR1; PACAP-R1; PACAP-R-1; PACAPR1A; PACAP-R1A; PACAP-R-1A; PACAPRI; pituitary adenylate cyclase activating polypeptide 1 receptor; pituitary adenylate cyclase activating polypeptide 1 receptor (1); pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop; pituitary adenylate cyclase activating polypeptide receptor; pituitary adenylate cyclase-activating polypeptide type 1 receptor; pituitary adenylate cyclase-activating polypeptide type 1 receptor hop 1 splice variant; pituitary adenylate cyclase-activating polypeptide type I receptor; pituitary adenylate cyclase-activating polypeptide type IA receptor; pvr1
Common Name PACAP Receptor
Gene Symbol ADCYAP1R1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.