Invitrogen™ Human PAG1 (aa 259-377) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102112	100 μL

Catalog No. RP102112 Supplier Invitrogen™ Supplier No. RP102112

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81959. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PAG (phosphoprotein associated with GEMs), also known as Cbp (Csk-binding protein), is a ubiquitously expressed 46 kDa transmembrane adaptor protein present in membrane rafts (glycosphingolipid-enriched microdomains), which however migrates on SDS PAGE gels anomalously as an 80 kDa molecule. Following tyrosine phosphorylation by Src family kinases, PAG binds and thereby activates the protein tyrosine kinase Csk, the major negative regulator of the Src family kinases. Signaling via the B-cell receptor in B cells or high affinity IgE receptor (FcepsilonRI) in mast cells leads to PAG increased tyrosine phosphorylation and Csk binding, while T cell receptor signaling causes PAG dephosphorylation, loss of Csk binding and increased activation of the protein tyrosine kinase Lck.

Specifications

• Accession Number: Q9NWQ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55824
• Name: Human PAG1 (aa 259-377) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CBP; Csk binding protein; csk-binding protein; F730007C19Rik; Pag; PAG 1; Pag1; PAG1B; phosphoprotein associated with glycosphingolipid microdomains 1; phosphoprotein associated with glycosphingolipid-enriched microdomains 1; phosphoprotein membrane anchor with glycosphingolipid microdomains 1; phosphoprotein transmembrane adaptor 1; phosphoprotein-associated with GEMs; pregnancy-associated glycoprotein 1; Pregnancy-specific protein B; PSP-B; similar to pregnancy-associated glycoprotein 1; transmembrane adapter protein PAG; transmembrane adaptor protein PAG; transmembrane phosphoprotein Cbp
• Common Name: PAG1
• Gene Symbol: PAG1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining