Invitrogen™ Human PAK1IP1 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108332	100 μL

Catalog No. RP108332 Supplier Invitrogen™ Supplier No. RP108332

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83124. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Negatively regulates the PAK1 kinase. PAK1 is a member of the PAK kinase family, which has been shown to play a positive role in the regulation of signaling pathways involving MAPK8 and RELA. PAK1 exists as an inactive homodimer, which is activated by binding of small GTPases such as CDC42 to an N-terminal regulatory domain. PAK1IP1 also binds to the N-terminus of PAK1, and inhibits the specific activation of PAK1 by CDC42. May be involved in ribosomal large subunit assembly (PubMed:24120868). [UniProt].

Specifications

• Accession Number: Q9NWT1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55003
• Name: Human PAK1IP1 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5830431I15Rik; 5930415H02Rik; AA419825; AI314040; AW556169; bA421M1.5; Gdpd1; glycerophosphodiester phosphodiesterase domain containing 1; hPIP1; MAK11; p21-activated protein kinase-interacting protein 1; PAK/PLC-interacting protein 1; PAK1 interacting protein 1; PAK1-interacting protein 1; PAK1IP1; PIP1; putative PAK inhibitor Skb15; RP11-421M1.5; WD repeat-containing protein 84; WDR84
• Common Name: PAK1IP1
• Gene Symbol: PAK1IP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTITNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMISFEIPEHHVIVSASSDGFIKMWK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining