Invitrogen™ Human Pallidin (aa 105-172) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98045	100 μL

Catalog No. RP98045 Supplier Invitrogen™ Supplier No. RP98045

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58992. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The aquaporins are a family of water-selective membrane channels. This gene encodes a member of a subset of aquaporins called the aquaglyceroporins. This protein allows passage of a broad range of noncharged solutes and also stimulates urea transport and osmotic water permeability. This protein may also facilitate the uptake of glycerol in hepatic tissue. The encoded protein may also play a role in specialized leukocyte functions such as immunological response and bactericidal activity. Alternate splicing results in multiple transcript variants.

Specifications

• Accession Number: Q9UL45
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 26258
• Name: Human Pallidin (aa 105-172) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: biogenesis of lysosomal organelles complex 1 subunit 6; biogenesis of lysosomal organelles complex-1, subunit 5, pallidin; biogenesis of lysosomal organelles complex-1, subunit 6, pallidin; biogenesis of lysosome-related organelles complex 1 subunit 6; biogenesis of organelles complex-1, subunit 6, pallidin; BLOC-1; BLOC-1 subunit 6; Bloc1s6; BLOS6; HPS9; P2; PA; PALLID; Pallid protein; pallid protein homolog; Pallidin; pallidin homolog; PLDN; Stx13bp1; syntaxin 13 binding protein 1; Syntaxin 13-interacting protein; syntaxin 13-interacting protein pallid
• Common Name: Pallidin
• Gene Symbol: BLOC1S6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining