Invitrogen™ Human PARD3 (aa 1017-1108) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94754	100 μL

Catalog No. RP94754 Supplier Invitrogen™ Supplier No. RP94754

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56475. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the kinesin 4 or subfamily of kinesin related proteins. This subfamily is also referred to as the chromokinesins. The encoded protein is an ATP dependent microtubule-based motor protein that is involved in the intracellular transport of membranous organelles. This protein also associates with condensed chromosome arms and may be involved maintaining chromosome integrity during mitosis. This protein may also be involved in the organization of the central spindle prior to cytokinesis. A pseudogene of this gene is found on chromosome X.

Specifications

• Accession Number: Q8TEW0
• Concentration: 4.20 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 56288
• Name: Human PARD3 (aa 1017-1108) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA960621; AI256638; ASBP; ASIP; atypical PKC isotype-specific interacting protein; atypical PKC isotype-specific-interacting protein; atypical PKC-specific binding protein; atypical PKC-specific-binding protein; Baz; bazooka; CTCL tumor antigen se2-5; D8Ertd580e; Ephrin-interacting protein; FLJ21015; PAR3; Par-3; par-3 (partitioning defective 3) homolog; par-3 family cell polarity regulator; par-3 family cell polarity regulator alpha; par-3 partitioning defective 3 homolog; PAR3A; PAR3alpha; PAR3-alpha; Pard3; PARD-3; PARD3A; partitioning defective 3 homolog; partitioning-defective 3 homolog; PHIP; PPP1R118; protein phosphatase 1, regulatory subunit 118; RP11-406D17.1; SE2-5L16; SE2-5LT1; SE2-5T2; three-PDZ containing protein similar to C. elegans PAR3 (partitioning defect)
• Common Name: PARD3
• Gene Symbol: Pard3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining