Abnova™ Human PC-LKC Partial ORF (NP_060145, 210 a.a. - 318 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-956-042	10 μg
89-956-043	25 μg

Catalog No. 89-956-042 Supplier Abnova™ Supplier No. H00054825Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene is a member of the protocadherin family, which represents a subset of the larger cadherin superfamily. The members of the protocadherin family encode non-classical cadherins that function as calcium-dependent cell-cell adhesion molecules. The kidney-expressed gene product has a signal peptide, nine cadherin repeat domains and a unique cytoplasmic region. This protocadherin represents a new candidate for tumor suppression. [provided by RefSeq]

Sequence: GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ

Specifications

• Accession Number: NP_060145
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 54825
• Molecular Weight (g/mol): 37.73kDa
• Name: PC-LKC (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FLJ20124/FLJ20383/MGC163154/PC-LKC/PCLKC
• Common Name: PCDH24
• Gene Symbol: PCDH24
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid