Invitrogen™ Human PDCD4 (aa 86-207) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93699	100 μL

Catalog No. RP93699 Supplier Invitrogen™ Supplier No. RP93699

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82957. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apoptosis, also known as programmed cell death, plays major roles in development and normal tissue turnover in addition to tumor formation. During this process, the expression patterns of numerous genes are radically altered. One such gene is the programmed cell death protein 4 (PDCD4), whose expression was found to be upregulated in all cell lines following the onset of apoptosis. PDCD4 encodes a tumor suppressor protein whose expression is lost in carcinomas of breast, colon, lung and prostate. It can bind to and inhibit the helicase activity of the eukaryotic translation initiation factor 4A and inhibit the transactivation and transformation mediated by the transcription factor AP-1. The kinase Akt regulates PDCD4 by phosphorylation, decreasing the ability of PDCD4 to interfere with the transactivation of AP-1-responsive promoter by c-Jun. There are two known isoforms of PDCD4.

Specifications

• Accession Number: Q53EL6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 27250
• Name: Human PDCD4 (aa 86-207) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: D19Ucla1; death up-regulated gene protein; death-upregulated; Dug; H731; Ma3; MGC33046; MGC33047; Neoplastic transformation inhibitor protein; nuclear antigen H731; Nuclear antigen H731-like; Pdcd4; programmed cell death 4; programmed cell death 4 (neoplastic transformation inhibitor); programmed cell death protein 4; Protein 197/15a; protein MA-3; RP11-348N5.4; Tis; topoisomerase-inhibitor suppressed protein
• Common Name: PDCD4
• Gene Symbol: PDCD4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining