Invitrogen™ Human PDE4D (aa 736-790) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96826	100 μL

Catalog No. RP96826 Supplier Invitrogen™ Supplier No. RP96826

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111224. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.

Specifications

• Accession Number: Q08499
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5144
• Name: Human PDE4D (aa 736-790) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9630011N22Rik; ACRDYS2; cAMP-specific 3',5'-cyclic phosphodiesterase 4D; cAMP-specific phosphodiesterase 4D; cAMP-specific phosphodiesterase PDE4D; cAMP-specific phosphodiesterase PDE4D6; cAMP-specific phosphodiesterase splice variant PDE4D8; cyclic AMP specific phosphodiesterase PDE4D5A; DKFZp686M11213; Dpde3; dunce; FLJ97311; HGNC:8783; HS PDE4DN2; HSPDE4D; PDE43; Pde4d; PDE4D3; PDE4D7; PDE4DN2; phosphodiesterase 4D; Phosphodiesterase 4D cAMP-specific (dunce; phosphodiesterase 4D, cAMP specific; phosphodiesterase 4D, cAMP-specific; Phosphodiesterase 4D, cAMP-specific (dunce; phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila); STRK1; testicular tissue protein Li 136
• Common Name: PDE4D
• Gene Symbol: Pde4d
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining