Invitrogen™ Human PDE5 (aa 459-600) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102418	100 μL

Catalog No. RP102418 Supplier Invitrogen™ Supplier No. RP102418

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52999. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The cyclic monophosphate nucleotides (cyclic adenosine monophosphate [cAMP] and cyclic guanosine monophosphate [cGMP] are found ubiquitously in mammalian cells and act as second messenger transducers to effect the intracellular actions of a variety of G protein coupled receptors (GPCRs) for hormones, cytokines, and neurotransmitters. Cyclic nucleotides are important intracellular second messenger which play important role in a variety of signal transduction process.

Specifications

• Accession Number: O76074
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8654
• Name: Human PDE5 (aa 459-600) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Cgbpde; CGB-PDE; cGMP-binding cGMP specific phosphodiesterase 5A2; cGMP-binding cGMP-specific 3',5'-cyclic nucleotide phosphodiesterase; cGMP-binding cGMP-specific phosphodiesterase; cGMP-binding/cGMP-specific phosphodiesterase; cGMP-specific 3',5'-cyclic phosphodiesterase; cGMP-specific phosphodiesterase PDE5A2; cGMP-specific phosphodiesterase type 5A; CN5A; Cn5n; PDE5; PDE5A; Pde5a1; PDE5A2; phosphodiesterase 5A; phosphodiesterase 5A, cGMP-specific; phosphodiesterase isozyme 5; phosphodiesterase type 5
• Common Name: PDE5
• Gene Symbol: Pde5a
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining