Invitrogen™ Human PDGF-C (aa 183-265) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89554	100 μL

Catalog No. RP89554 Supplier Invitrogen™ Supplier No. RP89554

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82379. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sphingosine Kinase 2 (Sphk2) catalyzes the phosphorylation of sphingosine to sphingosine 1 phosphate (S1P), an important signaling molecule with intra- and extracellular functions. Inside the cell S1P acts as a signaling molecule like other sphingolipid metabolites like ceramide and sphingosine. S1P has been implicated in regulating cell differentiation, calcium mobilization from intracellular stores, and apoptosis. The cell surface receptors for S1P are the EDG family of G protein-coupled receptors (S1P Receptors).These receptors couple to multiple G proteins (e.g. S1P1 couples to Gi whereas S1P2 and S1P3 couple to Gq, G13 in addition to Gi) and regulate a extremely wide range of cellular events including cell motility, survival, apoptosis, migration and cellcell interaction. Important roles for S1P have also been reported in regulation of cardiogenesis, vascular maturation, oocyte survival, immune cell trafficking, cells of the neuronal system and bone cells. S1P levels are regulated by the activity of Sphk (Sphk1 and Sphk2).

Specifications

• Accession Number: Q9NRA1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 56034
• Name: Human PDGF-C (aa 183-265) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110064L01Rik; AI647969; C76851; fallotein; MGC102297; Pdgfc; PDGF-C; PDGFC latent form; PDGFC receptor-binding form; platelet derived growth factor C; platelet-derived growth factor C; Platelet-derived growth factor C, latent form; Platelet-derived growth factor C, receptor-binding form; platelet-derived growth factor, C polypeptide; rScdfg; Scdgf; secretory growth factor-like protein; spinal cord-derived growth factor; UNQ174/PRO200; VEGF-E
• Common Name: PDGF-C
• Gene Symbol: PDGFC
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining