Invitrogen™ Human PDGF-D (aa 195-274) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103629	100 μL

Catalog No. RP103629 Supplier Invitrogen™ Supplier No. RP103629

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The platelet-derived growth factor (PDGF) family consists of four members; PDGF-A, PDGF-B, PDGF-C and PDGF-D (spinal cord-derived growth factor-B or iris-expressed growth factor). PDGF members form disulphide-bonded dimeric isoforms, which are important for growth, survival and function in several types of connective tissue cells. Their biological effects are mediated via two tyrosine kinase receptors, PDGFR-a and PDGFR-b, and PDGF-mediated signaling is critical for development of many organ systems. PDGF-D has a two-domain structure similar to PDGF-C and is secreted as a disulphide-linked homodimer, PDGF-DD. PDGF-D induces cellular transformation and promotes tumor growth by accelerating the proliferation rate of tumor cells and by stimulation of tumor neovascularization. PDGF-D may play a role in the development of brain tumors. The potential oncogenic activity of PDGF-DD may be important for the development and/or progression of prostate cancer. PDGF-D is expressed in fibroblastic adventitial cells, cultured endothelial cells and in a variety of tumor cell lines including those derived from ovarian, renal and lung cancers, as well as from astrocytomas and medulloblastomas. PDGF-D is expressed in the human kidney.

Specifications

• Accession Number: Q9GZP0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80310
• Name: Human PDGF-D (aa 195-274) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110003I09Rik; Iegf; Iris-expressed growth factor; MSTP036; Pdgfd; PDGF-D; PDGFD latent form; PDGFD receptor-binding form; platelet derived growth factor D; platelet-derived growth factor D; Platelet-derived growth factor D, latent form; Platelet-derived growth factor D, receptor-binding form; platelet-derived growth factor, D polypeptide; rSCDGF-B; SCDGFB; SCDGF-B; spinal cord derived growth factor B; spinal cord-derived growth factor B; spinal cord-derived growth factor-B; spinal-cord derived growth factor-B protein; UNQ1899/PRO4345
• Common Name: PDGF-D
• Gene Symbol: Pdgfd
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining