Invitrogen™ Human PDXK (aa 249-312) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95174	100 μL

Catalog No. RP95174 Supplier Invitrogen™ Supplier No. RP95174

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56394. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pyridoxal kinase (PDXK) converts vitamin B6 to pyridoxal-5-phosphate (PLP), an essential cofactor in the intermediate metabolism of amino acids and neurotransmitters. The PDXK gene encodes a 312-amino acid polypeptide, and expression of the cDNA reveals pyridoxal kinase activity. Northern blot analysis revealed that a major 1.5-kb PDXK transcript is expressed in all tissues tested. The expression of PDXK shows circadian oscillations. The expression of Pdxk in mouse liver and brain is regulated by the 3 PAR bZIP transcription factors, Dbp, Hlf, and Tef, which also show circadian oscillations in expression. Mice devoid of all 3 transcription factors show decreased levels of brain PLP, serotonin, and dopamine, and are highly susceptible to frequently lethal generalized spontaneous and audiogenic epilepsies.

Specifications

• Accession Number: O00764
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8566
• Name: Human PDXK (aa 249-312) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310036D04Rik; AA119688; C21orf124; C21orf97; C77999; epididymis secretory sperm binding protein Li 1a; HEL-S-1a; Pdxk; Pkh; PNK; PRED79; pyridoxal (pyridoxine, vitamin B6) kinase; pyridoxal kinase; pyridoxamine kinase; pyridoxine kinase; vitamin B6 kinase
• Common Name: PDXK
• Gene Symbol: PDXK
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining