Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human PEBP1 (aa 43-181) Control Fragment Recombinant Protein

Catalog No. RP89890
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89890 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89890 Supplier Invitrogen™ Supplier No. RP89890
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PBP binds ATP, opioids and phosphatidylethanolamine, exhibiting a lower affinity for phosphatidylinositol and phosphatidylcholine. This serine protease inhibitor inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase. PBP contains hippocampal cholinergic neurostimulating peptide (HCNP), which may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P30086
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 5037
Name Human PEBP1 (aa 43-181) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 23 kDa morphine-binding protein; Basic cytosolic 21 kDa protein; epididymis luminal protein 210; epididymis secretory protein Li 34; epididymis secretory protein Li 96; HCNP; HCNPpp; HEL-210; HEL-S-34; HEL-S-96; Hippocampal cholinergic neurostimulating peptide; KIAA0299; LDGF; MDGF; MOCA; neuropolypeptide h3; P23K; PBP; Pbp1; Pbpr; PEBP; PEBP1; PEBP-1; phosphatidylethanolamine binding protein; phosphatidylethanolamine binding protein 1; phosphatidylethanolamine-binding protein; phosphatidylethanolamine-binding protein 1; PPBP; prostatic binding protein; Prostatic-binding protein; Raf kinase inhibitor protein; Raf kinase inhibitory protein; Raf-1 inhibitor protein; Raf-1 kinase inhibitor protein; RKIP; similar to phosphatidylethanolamine binding protein; zgc:56033; zgc:76942
Common Name PEBP1
Gene Symbol PEBP1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.