Invitrogen™ Human PEG10 (aa 233-316) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100578	100 μL

Catalog No. RP100578 Supplier Invitrogen™ Supplier No. RP100578

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62299. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This is a paternally expressed imprinted gene that encodes transcripts containing two overlapping open reading frames start codon, have been reported for this gene. Increased expression of this gene is associated with hepatocellular carcinomas.

Specifications

• Accession Number: Q86TG7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23089
• Name: Human PEG10 (aa 233-316) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2-Mar; AA407948; EDR; embryonal carcinoma differentiation regulated; embryonal carcinoma differentiation regulated protein; Embryonal carcinoma differentiation-regulated protein; HB-1; KIAA1051; Mammalian retrotransposon-derived protein 2; MAR2; Mart2; MEF3 like 1; MEF3L; Mef3l1; MEF3-like protein 1; MyEF-3; MyEF-3 like; myelin expression factor 3; Myelin expression factor 3-like protein 1; paternally expressed 10; paternally expressed gene 10 protein; PEG10; Retrotransposon gag domain-containing protein 3; retrotransposon-derived gag-like polyprotein; Retrotransposon-derived protein PEG10; retrotransposon-derived protein PEG10-like; RGAG3; Ty3/Gypsy-like protein
• Common Name: PEG10
• Gene Symbol: PEG10
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining