Invitrogen™ Human PEX13 (aa 324-398) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102617	100 μL

Catalog No. RP102617 Supplier Invitrogen™ Supplier No. RP102617

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56941. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PEX13 (Peroxisomal Biogenesis Factor 13) is a gene located on chromosome 2p15 that encodes a peroxisomal membrane protein essential for the biogenesis and function of peroxisomes, which are cellular organelles involved in lipid metabolism and detoxification of reactive oxygen species. PEX13 is a component of the peroxisomal import machinery that specifically recognizes and binds to peroxisomal targeting signal 1 (PTS1) containing proteins, facilitating their import into the peroxisome matrix. Mutations in the PEX13 gene can lead to Zellweger spectrum disorders, a group of peroxisome biogenesis disorders (PBDs) characterized by defects in multiple peroxisomal metabolic pathways, leading to severe developmental issues, neurological deficits, and often early lethality. Studies of PEX13 have helped elucidate the mechanisms of peroxisomal protein import and the broader implications of peroxisomal dysfunction in human disease.

Specifications

• Accession Number: Q92968
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5194
• Name: Human PEX13 (aa 324-398) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: NALD; PBD11A; PBD11B; Peroxin-13; peroxisomal biogenesis factor 13; peroxisomal membrane protein PEX13; peroxisome biogenesis factor 13; Pex13; ZWS
• Common Name: PEX13
• Gene Symbol: PEX13
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLIPANYVKILGKRKGRKTVESSKVSKQQQSFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining