Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human PEX3 (aa 292-370) Control Fragment Recombinant Protein

Catalog No. RP95049
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95049 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95049 Supplier Invitrogen™ Supplier No. RP95049
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83635. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Peroxin 3, also known as PEX3 (peroxisomal biogenesis factor 3) or TRG18, is a 373 amino acid multi-pass membrane protein that localizes to peroxisomes and belongs to the Peroxin family. Expressed ubiquitously, Peroxin 3 interacts with Peroxin 19 and is involved in peroxisome biosynthesis and membrane vesicle assembly, as well as in the maintenance of peroxisomal integrity. Additionally, Peroxin 3 acts as a docking factor for Peroxin 19 and is required for the import of peroxisomal proteins. Defects in the gene encoding Peroxin 3 are the cause of peroxisome biogenesis disorder complementation group 12 (PBD-CG12) and Zellweger syndrome (ZwS), both of which arise from a failure of peroxisomal protein import.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P56589
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 8504
Name Human PEX3 (aa 292-370) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1700014F15Rik; 2810027F19Rik; 2900010N04Rik; PBD10A; Peroxin3; peroxin-3; peroxisomal assembly protein 3; peroxisomal assembly protein PEX3; Peroxisomal biogenesis factor 3; pex3; transformation-related protein 18; TRG18; zgc:56313
Common Name PEX3
Gene Symbol PEX3
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.