Invitrogen™ Human PHD2 (aa 206-294) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP88765	100 μL

Catalog No. RP88765 Supplier Invitrogen™ Supplier No. RP88765

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types.This gene encodes a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types.

Specifications

• Accession Number: Q9GZT9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54583
• Name: Human PHD2 (aa 206-294) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI503754; C1orf12; C1ORF12 antibody; ECYT3; egl nine homolog 1; egl nine-like protein 1; egl-9 family hypoxia inducible factor 1; egl-9 family hypoxia-inducible factor 1; EGLN 1 EGLN1; EGLN1; HALAH; HIF PH2; HIF prolyl hydroxylase 2; HIF-P4H 2; Hif-p4h-2; HIFPH2; HIF-PH2; HIF-prolyl hydroxylase 2; HPH2; HPH-2; Hypoxia-inducible factor prolyl hydroxylase 2; ORF13; P4H2; Phd2; PHD-2; PNAS-118; PNAS-137; Prolyl Hy; Prolyl hydroxylase domain-containing protein 2; SM20; SM-20; zinc finger MYND domain-containing protein 6; ZMYND6
• Common Name: PHD2
• Gene Symbol: Egln1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining