Invitrogen™ Human PHOX2B (aa 4-75) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108643	100 μL

Catalog No. RP108643 Supplier Invitrogen™ Supplier No. RP108643

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription factor involved in the development of several major noradrenergic neuron populations and the determination of neurotransmitter phenotype. The gene product is linked to enhancement of second messenger-mediated activation of the dopamine beta-hydroylase, c-fos promoters and several enhancers, including cyclic amp-response element and serum-response element.

Specifications

• Accession Number: Q99453
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8929
• Name: Human PHOX2B (aa 4-75) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: dilated pupils 1; Dilp1; GENA 269; LOW QUALITY PROTEIN: paired mesoderm homeobox protein 2B; NBLST2; NBPhox; neuroblastoma paired-type homeobox protein; neuroblastoma Phox; paired like homeobox 2B; paired mesoderm homeobox 2b; paired mesoderm homeobox protein 2B; Paired-like homeobox 2B; PHOX2B; PHOX2B homeodomain protein; Pmx2b
• Common Name: PHOX2B
• Gene Symbol: PHOX2B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining