Invitrogen™ Human PHPT1 (aa 5-117) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91733	100 μL

Catalog No. RP91733 Supplier Invitrogen™ Supplier No. RP91733

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54283. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the protein tyrosine phosphatase family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This protein contains a C-terminal PTP domain and an N-terminal domain homologous to the band 4.1 superfamily of cytoskeletal-associated proteins. P97, a cell cycle regulator involved in a variety of membrane related functions, has been shown to be a substrate of this PTP. This PTP was also found to interact with, and be regulated by adaptor protein 14-3-3 beta. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9NRX4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 29085
• Name: Human PHPT1 (aa 5-117) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 14 kDa phosphohistidine phosphatase; 14kDa phosphohistidine phosphatase; 1700008C22Rik; CGI-202; epididymis secretory sperm binding protein Li 132P; HEL-S-132P; HSPC141; hypothetical protein LOC445172; phosphohistidine phosphatase 1; PHP; PHP14; Phpt1; Protein histidine phosphatase; protein janus-A homolog; PTPH1; PTP-H1; sex-regulated protein janus-a; Unknown (protein for MGC:133682); wu:fb50e08; zgc:101086
• Common Name: PHPT1
• Gene Symbol: Phpt1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining