Invitrogen™ Human PIK3CD Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102971	100 μL

Catalog No. RP102971 Supplier Invitrogen™ Supplier No. RP102971

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83748. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.

Specifications

• Accession Number: O00329
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5293
• Name: Human PIK3CD Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410099E07Rik; 2610208K16Rik; APDS; AW545373; catalytic phosphatidylinositol 3-kinase delta; IMD14; p100 delta; p110D; p110delta; phosphatidylinositol 3-kinase catalytic delta polypeptide; phosphatidylinositol 3-kinase catalytic subunit delta; phosphatidylinositol 3-kinase p110 delta; phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta; Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta; phosphoinositide 3 kinase P110delta; phosphoinositide-3-kinase C; phosphoinositide-3-kinase, catalytic, delta polypeptide; phosphoinositide-3-kinase, catalytic, delta polypeptide variant p37delta; PI3K; PI3K delta; pi3kcd; PI3Kdelta; PI3K-delta; PI3-kinase p110 subunit delta; PI3-kinase subunit delta; PI3Kp110delta; PI3K-p110delta; PIK3CD; ptdIns-3-kinase subunit delta; ptdIns-3-kinase subunit p110-delta
• Common Name: PIK3CD
• Gene Symbol: PIK3CD
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining