Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human PIMT (aa 642-733) Control Fragment Recombinant Protein

Catalog No. RP93799
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93799 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93799 Supplier Invitrogen™ Supplier No. RP93799
Only null left
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82895 (PA5-82895. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96RS0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 96764
Name Human PIMT (aa 642-733) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Cap-specific guanine-N2 methyltransferase; CLL-associated antigen KW-2; D4Ertd800e; HCA137; Hepatocellular carcinoma-associated antigen 137; LOW QUALITY PROTEIN: trimethylguanosine synthase; NCOA6IP; nuclear receptor coactivator 6 interacting protein; nuclear receptor coactivator 6-interacting protein; Pimt; PIPMT; PRIP-interacting protein with methyltransferase motif; TGS1; tgs1 {ECO:0000250; Trimethylguanosine synthase; trimethylguanosine synthase 1; trimethylguanosine synthase homolog; trimethylguanosine synthase homolog (S. cerevisiae); trimethylguanosine synthase-like protein; UniProtKB:Q96RS0}
Common Name PIMT
Gene Symbol TGS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.