Invitrogen™ Human PIMT (aa 642-733) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82895 (PA5-82895. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation. [UniProt]

Specifications

• Accession Number: Q96RS0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 96764
• Name: Human PIMT (aa 642-733) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cap-specific guanine-N2 methyltransferase; CLL-associated antigen KW-2; D4Ertd800e; HCA137; Hepatocellular carcinoma-associated antigen 137; LOW QUALITY PROTEIN: trimethylguanosine synthase; NCOA6IP; nuclear receptor coactivator 6 interacting protein; nuclear receptor coactivator 6-interacting protein; Pimt; PIPMT; PRIP-interacting protein with methyltransferase motif; TGS1; tgs1 {ECO:0000250; Trimethylguanosine synthase; trimethylguanosine synthase 1; trimethylguanosine synthase homolog; trimethylguanosine synthase homolog (S. cerevisiae); trimethylguanosine synthase-like protein; UniProtKB:Q96RS0}
• Common Name: PIMT
• Gene Symbol: TGS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining